PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01778.1.g00230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 327aa    MW: 35803.9 Da    PI: 5.8086
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01778.1.g00230.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.83.7e-111686148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......................TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......................kgRtlkqcksrwqkyl 48
                                  +g W++eEde+l++ +  +G g+W+++++  g                       + R++k+c++rw +yl
  Zmw_sc01778.1.g00230.1.am.mk 16 KGLWSPEEDEKLYNHIISHGVGCWSSVPKLAGnarngrhrrprlieadvcleragLQRCGKSCRLRWINYL 86
                                  678*******************8888888888888888888888888888*******************97 PP

2Myb_DNA-binding47.54e-1592135146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg ++++E+ l+v +++ lG++ W+ Ia++++ gRt++++k++w++
  Zmw_sc01778.1.g00230.1.am.mk  92 RGGFSQQEEGLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 135
                                   7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6321159IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-211189IPR009057Homeodomain-like
SuperFamilySSF466891.41E-2313133IPR009057Homeodomain-like
SMARTSM007178.2E-91588IPR001005SANT/Myb domain
PfamPF002494.6E-101686IPR001005SANT/Myb domain
CDDcd001672.25E-81986No hitNo description
PROSITE profilePS5129423.74887141IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2590141IPR009057Homeodomain-like
SMARTSM007177.0E-1491139IPR001005SANT/Myb domain
PfamPF002494.4E-1392136IPR001005SANT/Myb domain
CDDcd001673.31E-1095134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRLSGGGGV QPKLRKGLWS PEEDEKLYNH IISHGVGCWS SVPKLAGNAR NGRHRRPRLI  60
EADVCLERAG LQRCGKSCRL RWINYLRPDL KRGGFSQQEE GLIVALHEIL GNRWSQIASH  120
LPGRTDNEIK NFWNSCLKKK LRQRGIDPST HKPISGGADA AAALPEDQDR KPVAVDAGPA  180
QKQPAVFDPF PATDFGFDLA NVSAFYGQYD DAKASDDAVG LAVDYCSVLD VSVSENLGYG  240
ESSSNSSNWN CAEMSNVLDG DALDWASGGG GCAKAEPFTE MERRCHSGGW RVEVDDDALE  300
LEHKFAALPG SCHEQSLAHF DFNLEYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241014121128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142LKKKLRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-142PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-105MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3Z8601e-142K3Z860_SETIT; Uncharacterized protein
STRINGSi022730m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391